Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT5GKHN)
| DTT Name | Lymphocyte antigen 6K (LY6K) | ||||
|---|---|---|---|---|---|
| Synonyms | Ly-6K; CO16 | ||||
| Gene Name | LY6K | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS |
||||
| Function | Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth. | ||||
| Reactome Pathway | |||||
