Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT5TQNZ)
| DTT Name | Gamma-synuclein (SNCG) | ||||
|---|---|---|---|---|---|
| Synonyms | Synoretin; Persyn; PRSN; Breast cancer-specific gene 1 protein; BCSG1 | ||||
| Gene Name | SNCG | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Synuclein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTK
EQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE EAQSGGD |
||||
| Function |
May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. Plays a role in neurofilament network integrity.
|
||||