Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT63M7Q)
| DTT Name | Melanoma-associated antigen 1 (MAGEA1) | ||||
|---|---|---|---|---|---|
| Synonyms | Melanomaassociated antigen 1; MAGE1A; MAGE1 antigen; MAGE1; MAGE-1 antigen; Cancer/testis antigen 1.1; CT1.1; Antigen MZ2E; Antigen MZ2-E | ||||
| Gene Name | MAGEA1 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Melanoma associated antigen
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQG
ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAR EPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD GLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT QDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREA ALREEEEGV |
||||
| Function |
May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
