Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT64REZ)
| DTT Name | Neuropeptide Y (NPY) | ||||
|---|---|---|---|---|---|
| Synonyms | Pro-neuropeptide Y | ||||
| Gene Name | NPY | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
||||
| Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
