Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT6ZFQ4)
| DTT Name | Rotamase B (PPIB) | ||||
|---|---|---|---|---|---|
| Synonyms | SCYLP; S-cyclophilin; Peptidyl-prolyl cis-trans isomerase B; PPIase B; Cyclophilin B; CYPB; CYP-S1 | ||||
| Gene Name | PPIB | ||||
| DTT Type |
Successful target
|
[1] | |||
| BioChemical Class |
Cis-trans-isomerase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 5.2.1.8
|
||||
| Sequence |
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE |
||||
| Function | PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. | ||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
