Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT716MY)
| DTT Name | S100 calcium-binding protein A6 (S100A6) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein S100-A6; Prolactin receptor-associated protein; PRA; MLN 4; Growth factor-inducible protein 2A9; Calcyclin; CACY | ||||
| Gene Name | S100A6 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
S100 calcium-binding protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG |
||||
| Function |
May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. May function as calcium sensor and modulator, contributing to cellular calcium signaling.
|
||||