Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT735V2)
| DTT Name | Phosphatidylethanolamine N-methyltransferase (PEMT) | ||||
|---|---|---|---|---|---|
| Synonyms | PEMT2; PEAMT | ||||
| Gene Name | PEMT | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Methyltransferase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 2.1.1.17
|
||||
| Sequence |
MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTI
LLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGD YFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYE EPFTAEIYRQKASGSHKRS |
||||
| Function | Catalyzes three sequential methylation of phosphatidylethanolamine (pe) by adomet, thus producing phosphatidylcholine (pc). | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
