Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7ILZ1)
| DTT Name | SLAM family member 7 SLAMF7 (CS1) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ576/PRO1138; SLAM family member 7; Protein 19A; Novel Ly9; Membrane protein FOAP-12; CRACC; CD319; CD2-like receptor-activating cytotoxic cells; CD2 subset 1 | ||||
| Gene Name | SLAMF7 | ||||
| DTT Type | 
                     Successful target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Immunoglobulin 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL 
                        
                    VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI  | 
            ||||
| Function | 
                                         
                        SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines. Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family.
                        
                     
                                     | 
            ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Approved Drug(s) Targeting This DTT 
                                            
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 
                     6 Clinical Trial Drug(s) Targeting This DTT 
                                        
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | Market watch: Upcoming catalysts in Q2 2015. Nat Rev Drug Discov. 2015 Apr;14(4):228. | ||||
|---|---|---|---|---|---|
| 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
| 3 | ClinicalTrials.gov (NCT04156269) BCMA-CS1 Compound CAR (cCAR) T Cells for Relapsed/Refractory Multiple Myeloma. U.S. National Institutes of Health. | ||||
| 4 | ClinicalTrials.gov (NCT03710421) CS1-CAR T Therapy Following Chemotherapy in Treating Patients With Relapsed or Refractory Multiple Myeloma | ||||
| 5 | Clinical pipeline report, company report or official report of Mustang Bio. | ||||
| 6 | ClinicalTrials.gov (NCT04142619) Study Evaluating Safety and Efficacy of UCART Targeting CS1 in Patients With Relapsed/Refractory Multiple Myeloma (MELANI-01). U.S. National Institutes of Health. | ||||
