Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7JUKC)
| DTT Name | Bcl-2-binding component 3 (BBC3) | ||||
|---|---|---|---|---|---|
| Synonyms | p53 upregulated modulator of apoptosis; p53 up-regulated modulator of apoptosis; PUMA; JFY1; JFY-1; Bcl2binding component 3 | ||||
| Gene Name | BBC3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
B-cell lymphoma Bcl-2
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC
APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP LPRGHRAPEMEPN |
||||
| Function |
Functions by promoting partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53. Regulates ER stress-induced neuronal apoptosis. Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway |
|
||||
