Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7JUKC)
| DTT Name | Bcl-2-binding component 3 (BBC3) | ||||
|---|---|---|---|---|---|
| Synonyms | p53 upregulated modulator of apoptosis; p53 up-regulated modulator of apoptosis; PUMA; JFY1; JFY-1; Bcl2binding component 3 | ||||
| Gene Name | BBC3 | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| BioChemical Class | 
                     B-cell lymphoma Bcl-2 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC 
                        
                    APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP LPRGHRAPEMEPN  | 
            ||||
| Function | 
                                         
                        Functions by promoting partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53. Regulates ER stress-induced neuronal apoptosis. Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis.
                        
                     
                                     | 
            ||||
| KEGG Pathway | |||||
| Reactome Pathway | 
                                    
  | 
            ||||
