Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT7KTSR)

DTT Name	Immunoglobulin gamma Fc receptor III (FCGR3)
Synonyms	Low affinity immunoglobulin gamma Fc region receptor III; IgG Fc receptor III; IGFR3; FcRIIIb; FcRIIIa; FcRIII; FcR-10; Fc-gamma RIII; FCGR3; FCG3; CD16
Gene Name	FCGR3A
DTT Type	Successful target	[1]
BioChemical Class	Immunoglobulin
UniProt ID	FCG3A_HUMAN ; FCG3B_HUMAN
TTD ID	T82240
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW KDHKFKWRKDPQDK
Function	Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
KEGG Pathway	Phagosome (hsa04145 ) Osteoclast differentiation (hsa04380 ) Natural killer cell mediated cytotoxicity (hsa04650 ) Fc gamma R-mediated phagocytosis (hsa04666 ) Leishmaniasis (hsa05140 ) Staphylococcus aureus infection (hsa05150 ) Tuberculosis (hsa05152 ) Systemic lupus erythematosus (hsa05322 )
Reactome Pathway	FCGR activation (R-HSA-2029481 ) Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 ) Role of phospholipids in phagocytosis (R-HSA-2029485 ) FCGR3A-mediated IL10 synthesis (R-HSA-9664323 ) FCGR3A-mediated phagocytosis (R-HSA-9664422 ) Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GMA-161	DMGVJLB	Idiopathic thrombocytopenic purpura	3B64.10	Approved (orphan drug)	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GTB-3550	DMK2RIB	Acute myelogenous leukaemia	2A41	Phase 1/2	[2]
------------------------------------------------------------------------------------

References

1	Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
2	Clinical pipeline report, company report or official report of GT Biopharma.