Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7NJSE)
| DTT Name | B-cell-activating factor receptor (TNFRSF13C) | ||||
|---|---|---|---|---|---|
| Synonyms | Tumor necrosis factor receptor superfamily member 13C; CD268; BR3; BLyS receptor 3; BAFFR; BAFF-R; BAFF receptor; B cell-activating factor receptor | ||||
| Gene Name | TNFRSF13C | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Cytokine receptor
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG PEQQ |
||||
| Function | Promotes the survival of mature B-cells and the B-cell response. B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
