Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7ORQ6)
| DTT Name | CD40LG messenger RNA (CD40LG mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms |
Tumor necrosis factor ligand superfamily member 5 (mRNA); TRAP (mRNA); TNFSF5 (mRNA); TNF-related activation protein (mRNA); T-cell antigen Gp39 (mRNA); T cell antigen Gp39 (mRNA); CD40L (mRNA); CD40-L (mRNA); CD40 ligand (mRNA); CD154 antigen (mRNA); CD154 (mRNA)
|
||||
| Gene Name | CD40LG | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN VTDPSQVSHGTGFTSFGLLKL |
||||
| Function |
Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. Induces tyrosine phosphorylation of isoform 3 of CD28. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. Cytokine that binds to CD40/TNFRSF5.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||