Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7QSMG)
| DTT Name | Testis-enhanced gene transcript protein (TMBIM6) | ||||
|---|---|---|---|---|---|
| Synonyms | Testis enhanced gene transcript; TMBIM6; BI-1 | ||||
| Gene Name | TMBIM6 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLS
ALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMG TAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVV MCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK |
||||
| Function | Suppressor of apoptosis. Modulates unfolded protein response signaling. Modulate ER calcium homeostasis by acting as a calcium-leak channel. | ||||
| KEGG Pathway | |||||
