Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7YM8D)
| DTT Name | Protein tyrosine phosphatase IVA 3 (PRL-3) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein-tyrosine phosphatase of regenerating liver 3; Protein-tyrosine phosphatase 4a3; Protein tyrosine phosphatase type IVA 3; PRL3; PRL-3 | ||||
| Gene Name | PTP4A3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Phosphoric monoester hydrolase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
||||
| Function |
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
References
