Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8CWJG)
| DTT Name | Alpha-crystallin A chain (CRYAA) | ||||
|---|---|---|---|---|---|
| Synonyms | HspB4; Heat shock protein beta-4; CRYA1 | ||||
| Gene Name | CRYAA | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Heat shock protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS |
||||
| Function | Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. Contributes to the transparency and refractive index of the lens. | ||||
| KEGG Pathway | |||||
