Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8CWJG)
| DTT Name | Alpha-crystallin A chain (CRYAA) | ||||
|---|---|---|---|---|---|
| Synonyms | HspB4; Heat shock protein beta-4; CRYA1 | ||||
| Gene Name | CRYAA | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Heat shock protein 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                        MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG 
                    
                ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS  | 
            ||||
| Function | Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. Contributes to the transparency and refractive index of the lens. | ||||
| KEGG Pathway | |||||
