Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8I4WB)

DTT Name	Macrophage inflammatory protein 1-alpha (CCL3)
Synonyms	Tonsillar lymphocyte LD78 alpha protein; Small-inducible cytokine A3; SIS-beta; SCYA3; PAT 464.1; Macrophage Inflammatory Protein-1alpha Nuclear Protein; MNP; MIP1A; MIP-1-alpha; G0S19-1 protein; G0S19-1; G0/G1 switch regulatory protein 19-1; C-C motif chemokine 3
Gene Name	CCL3
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine: CC chemokine
UniProt ID	CCL3_HUMAN
TTD ID	T97765
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Function	Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Monokine with inflammatory and chemokinetic properties.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Chemokine signaling pathway (hsa04062 ) Toll-like receptor signaling pathway (hsa04620 ) Salmonella infection (hsa05132 ) Chagas disease (American trypanosomiasis) (hsa05142 ) Rheumatoid arthritis (hsa05323 )
Reactome Pathway	Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nagrestipen	DM3E20L	Bone marrow transplantation	QB63.6	Phase 1	[1]
------------------------------------------------------------------------------------

References

1	Macrophage inflammatory protein derivative ECI301 enhances the alarmin-associated abscopal benefits of tumor radiotherapy. Cancer Res. 2014 Sep 15;74(18):5070-8.