Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8RDXP)

DTT Name	Troponin C (TN-C)
Synonyms	Troponin C, slow skeletal and cardiac muscles; TNNC
Gene Name	TNNC1
DTT Type	Successful target	[1]
UniProt ID	TNNC1_HUMAN
TTD ID	T12966
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Function	Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
KEGG Pathway	Calcium signaling pathway (hsa04020 ) Cardiac muscle contraction (hsa04260 ) Adrenergic signaling in cardiomyocytes (hsa04261 ) Hypertrophic cardiomyopathy (HCM) (hsa05410 ) Dilated cardiomyopathy (hsa05414 )
Reactome Pathway	Striated Muscle Contraction (R-HSA-390522 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dihydroxyaluminium	DM8YXKW	Skin inflammation	EF20.Y	Approved	[2]
Levosimendan	DMKBOS2	Congestive heart failure	BD10	Approved	[1]
------------------------------------------------------------------------------------

References

1	Timing of levosimendan in cardiac surgery. Anadolu Kardiyol Derg. 2009 Jun;9(3):223-30.
2	A retrospective analysis of changes in inflammatory markers in patients treated with bacterial viruses. Clin Exp Med. 2009 Dec;9(4):303-12.