Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8RXO5)

• DTT Name: GABA transporter-3 (SLC6A11)
• Synonyms: Solute carrier family 6 member 11; Sodium- and chloride-dependent GABA transporter 3; GAT3; GAT-3; GABT3
• Gene Name: SLC6A11
• DTT Type: Clinical trial target; [1]
• UniProt ID: S6A11_HUMAN
• TTD ID: T38200
• Sequence:
  MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFV
  LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
  CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
  VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
  FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
  DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
  YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
  AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
  IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKY
  NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
  GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
• Function: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
• KEGG Pathway:
  Synaptic vesicle cycle (hsa04721)
  GABAergic synapse (hsa04727)
• Reactome Pathway:
  Creatine metabolism (R-HSA-71288)
  Reuptake of GABA (R-HSA-888593)
  Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GSK683699	DMTW79H	Inflammatory bowel disease	DD72	Phase 2	[1]

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2,4-Diamino-butyric acid(GABA)	DMAOGBP	Discovery agent	N.A.	Investigative	[2]
4-Hydroxy-piperidine-3-carboxylic acid	DM9VQ0T	Discovery agent	N.A.	Investigative	[3]
Beta-Alanine	DMC64EI	Discovery agent	N.A.	Investigative	[4]
NIPECOTIC ACID	DMPV450	Discovery agent	N.A.	Investigative	[1]

References

• [1] Epimeric cis-decahydroquinoline-5-carboxylic acids: effects on gamma-aminobutyric acid uptake and receptor binding in vitro. J Med Chem. 1981 Jul;24(7):788-94.
• [2] Glycine antagonists. Synthesis, structure, and biological effects of some bicyclic 5-isoxazolol zwitterions. J Med Chem. 1986 Feb;29(2):224-9.
• [3] Hydroxy- and amino-substituted piperidinecarboxylic acids as gamma-aminobutyric acid agonists and uptake inhibitors. J Med Chem. 1982 Oct;25(10):1157-62.
• [4] Stable expression of a neuronal gamma-aminobutyric acid transporter, GAT-3, in mammalian cells demonstrates unique pharmacological properties and ion dependence. Mol Pharmacol. 1994 Sep;46(3):550-7.