Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8SGZK)
| DTT Name | Pancreas duodenum homeobox 1 (PDX1) | ||||
|---|---|---|---|---|---|
| Synonyms |
Somatostatin-transactivating factor 1; STF1; STF-1; Pancreas/duodenum homeobox protein 1; PDX-1; Islet/duodenum homeobox-1; Insulin upstream factor 1; Insulin promoter factor 1; IUF-1; IPF1; IPF-1; IDX-1; Glucose-sensitive factor; GSF
|
||||
| Gene Name | PDX1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG
SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR |
||||
| Function |
Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
