Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT958S6)
| DTT Name | Ras-related protein Rab-9A (RAB9A) | ||||
|---|---|---|---|---|---|
| Synonyms | RAB9A | ||||
| Gene Name | RAB9A | ||||
| DTT Type | 
                     Successful target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Small GTPase superfamily 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI 
                        
                    WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD HLIQTDTVNLHRKPKPSSSCC  | 
            ||||
| Function | Involved in the transport of proteins between the endosomes and the trans Golgi network. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Approved Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
| 
                     1 Investigative Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
