Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT96HUR)

• DTT Name: Cell surface A33 antigen (GPA33)
• Synonyms: GPA33; A33 cognate antigen; A33 antigen
• Gene Name: GPA33
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: GPA33_HUMAN
• TTD ID: T57001
• Sequence:
  MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDK
  LLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVS
  LMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNI
  LNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVG
  IAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREAYEEPPEQLRELSREREEEDD
  YRQEEQRSTGRESPDHLDQ
• Function: May play a role in cell-cell recognition and signaling.

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KRN-330	DMA5B1S	Colorectal cancer	2B91.Z	Phase 1/2	[1]
MGD007	DMAHWLR	Colorectal cancer	2B91.Z	Phase 1/2	[2]
HuA33	DMB3LQU	Colorectal cancer	2B91.Z	Phase 1	[3]
Radiolabelled-huA33	DMIEJ0W	Colorectal cancer	2B91.Z	Phase 1	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	1.62E-10	-1.19	-5.77

References

• [1] Phase 1/2 study of KRN330, a fully human anti-A33 monoclonal antibody, plus irinotecan as second-line treatment for patients with metastatic colorectal cancer. Invest New Drugs. 2014 Aug;32(4):682-90.
• [2] Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801.
• [3] (124)I-huA33 antibody PET of colorectal cancer. J Nucl Med. 2011 Aug;52(8):1173-80.