Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT9AXQM)
DTT Name | TGFA messenger RNA (TGFA mRNA) | ||||
---|---|---|---|---|---|
Synonyms | TGF-alpha (40-89) (mRNA); TGF type 1 (40-89) (mRNA); Protransforming growth factor alpha (40-89) (mRNA); ETGF (40-89) (mRNA); EGF-like TGF (40-89) (mRNA) | ||||
Gene Name | TGFA | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
mRNA target
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
||||
Function | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. | ||||
KEGG Pathway |
|
||||
Reactome Pathway |
|
||||