General Information of Drug Therapeutic Target (DTT) (ID: TT9AXQM)

DTT Name TGFA messenger RNA (TGFA mRNA)
Synonyms TGF-alpha (40-89) (mRNA); TGF type 1 (40-89) (mRNA); Protransforming growth factor alpha (40-89) (mRNA); ETGF (40-89) (mRNA); EGF-like TGF (40-89) (mRNA)
Gene Name TGFA
DTT Type
Literature-reported target
[1]
BioChemical Class
mRNA target
UniProt ID
TGFA_HUMAN
TTD ID
T40516
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Function TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
KEGG Pathway
EGFR tyrosine kinase inhibitor resistance (hsa01521 )
MAPK signaling pathway (hsa04010 )
ErbB signaling pathway (hsa04012 )
Ras signaling pathway (hsa04014 )
PI3K-Akt signaling pathway (hsa04151 )
Estrogen signaling pathway (hsa04915 )
Pathways in cancer (hsa05200 )
Colorectal cancer (hsa05210 )
Renal cell carcinoma (hsa05211 )
Pancreatic cancer (hsa05212 )
Glioma (hsa05214 )
Prostate cancer (hsa05215 )
Non-small cell lung cancer (hsa05223 )
Hepatocellular carcinoma (hsa05225 )
Reactome Pathway
Signaling by EGFR (R-HSA-177929 )
GRB2 events in EGFR signaling (R-HSA-179812 )
GAB1 signalosome (R-HSA-180292 )
SHC1 events in EGFR signaling (R-HSA-180336 )
EGFR downregulation (R-HSA-182971 )
COPII-mediated vesicle transport (R-HSA-204005 )
EGFR interacts with phospholipase C-gamma (R-HSA-212718 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Inhibition of Signaling by Overexpressed EGFR (R-HSA-5638303 )
RAF/MAP kinase cascade (R-HSA-5673001 )
Cargo concentration in the ER (R-HSA-5694530 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
Clathrin-mediated endocytosis (R-HSA-8856828 )
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors (R-HSA-8866910 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Estrogen-dependent gene expression (R-HSA-9018519 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
PIP3 activates AKT signaling (R-HSA-1257604 )

References

1 Maternal separation suppresses TGF alpha mRNA expression in the prefrontal cortex of male and female neonatal C57BL/6 mice. Brain Res Dev Brain Res. 2004 Aug 18;152(1):73-7.