Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT9AZWY)
| DTT Name | HSPB1 messenger RNA (HSPB1 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | 
                        Stress-responsive protein 27 (mRNA); SRP27 (mRNA); HspB1 (mRNA); Heat shock protein beta-1 (mRNA); Heat shock 27 kDa protein (mRNA); HSP28 (mRNA); HSP 27 (mRNA); Estrogen-regulated 24 kDa protein (mRNA); 28 kDa heat shock protein (mRNA)
                        
                     | ||||
| Gene Name | HSPB1 | ||||
| DTT Type | Discontinued target | [1] | |||
| BioChemical Class | mRNA target | ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                            MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK | ||||
| Function | 
                        Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins. Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state.
                        
                     | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 Discontinued Drug(s) Targeting This DTT 
 | ||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
