Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT9F4MC)
| DTT Name | Riboflavin-binding protein | ||||
|---|---|---|---|---|---|
| Synonyms | Retbindin; Riboflavin-binding protein, plasma form; Riboflavin-binding protein, yolk major form; RBP; Riboflavin-binding protein, yolk minor form | ||||
| Gene Name | RTBDN | ||||
| BioChemical Class |
Single Protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCC
PSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQ AWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARH CFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP |
||||
| Function | Required for the transport of riboflavin to the developing oocyte. | ||||
