Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9H85R)

• DTT Name: Corticosteroid 11-beta-dehydrogenase 2 (HSD11B2)
• Synonyms: NAD-dependent 11-beta-hydroxysteroid dehydrogenase; HSD11B2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-HSD2; 11-DH2; 11 beta-hydroxysteroid dehydrogenase type 2; 11 beta-HSD2
• Gene Name: HSD11B2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Short-chain dehydrogenases reductase
• UniProt ID: DHI2_HUMAN
• TTD ID: T43721
• EC Number: EC 1.1.1.-
• Sequence:
  MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
  LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
  AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
  PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
  LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
  EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
  RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
• Function: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
• KEGG Pathway:
  Steroid hormone biosynthesis (hsa00140)
  Aldosterone-regulated sodium reabsorption (hsa04960)
• Reactome Pathway: Glucocorticoid biosynthesis (R-HSA-194002)
• BioCyc Pathway: MetaCyc:ENSG00000176387-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RG-7234	DM5RAB9	Type-2 diabetes	5A11	Phase 2	[1]

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
11-keto-beta-boswellicacid	DMM6CJI	Discovery agent	N.A.	Investigative	[2]
3-acetyl-11-keto-beta-boswellic acid	DMGO2D7	Discovery agent	N.A.	Investigative	[2]
Ganoderic acid A	DM42EVG	Discovery agent	N.A.	Investigative	[2]
[(125)I] RB129	DMX0G7E	Discovery agent	N.A.	Investigative	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Type 2 diabetes	5A11	Liver tissue	1.65E-01	-0.18	-1.16

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Corticosteroid 11-beta-dehydrogenase 2 (HSD11B2) DME Info
• Gene Name: HSD11B2

4 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Beclomethasone	DMZPHIK	Allergic rhinitis	CA08.0	Approved	[4]
Betamethasone Valerate	DMMIAXO	Dermatological disease	DA24.Y	Approved	[4]
Cortisone Acetate	DMG8K57	Acne vulgaris	ED80	Approved	[5]
Dexamethasone	DMMWZET	Acute adrenal insufficiency		Approved	[4]

1 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dehydrocorticosterone	DM48KMB	N. A.	N. A.	Investigative	[5]

References

• [1] New Therapeutic Strategies for Type 2 Diabetes: Small Molecule Approaches. 2012. Chapter 5. Page(131).
• [2] 11beta-Hydroxysteroid dehydrogenase 1 inhibiting constituents from Eriobotrya japonica revealed by bioactivity-guided isolation and computational a... Bioorg Med Chem. 2010 Feb 15;18(4):1507-15.
• [3] Abnormal expression of 11 beta-hydroxysteroid dehydrogenase type 2 in human pituitary adenomas: a prereceptor determinant of pituitary cell proliferation. Oncogene. 2003 Mar 20;22(11):1663-7.
• [4] Metabolism of synthetic steroids by the human placenta. Placenta. 2007 Jan;28(1):39-46.
• [5] Comparative enzymology of 11beta-hydroxysteroid dehydrogenase type 1 from six species. J Mol Endocrinol. 2005 Aug;35(1):89-101.