Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTADIOY)
| DTT Name | AS1 14-3-3 protein eta (YWHAH) | ||||
|---|---|---|---|---|---|
| Synonyms | YWHA1; Protein AS1; 14-3-3 protein eta | ||||
| Gene Name | YWHAH | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN |
||||
| Function |
Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1. Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway |
|
||||
