Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTATDGJ)

• DTT Name: Calcium signal-modulating cyclophilin ligand (CAML)
• Synonyms: cyclophilin
• Gene Name: CAMLG
• DTT Type: Clinical trial target; [1]
• UniProt ID: CAMLG_HUMAN
• TTD ID: T07601
• Sequence:
  MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEE
  SQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKP
  PECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
  TTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKT
  TVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
• Function: Likely involved in the mobilization of calcium as a result of the TCR/CD3 complex interaction. Binds to cyclophilin B.
• Reactome Pathway: Insertion of tail-anchored proteins into the endoplasmic reticulum membrane (R-HSA-9609523)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alisporivir	DM83EBP	Duchenne dystrophy	8C70	Phase 3	[1]
SCY-635	DM1C9NQ	Hepatitis C virus infection	1E51.1	Phase 2	[2]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SCY-641	DMELFBU	Ocular inflammation	9C61.24	Preclinical	[3]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
D-43787	DM0YFZ6	Allergy	4A80-4A85	Terminated	[4]

References

• [1] DEB025 (Alisporivir) inhibits hepatitis C virus replication by preventing a cyclophilin A induced cis-trans isomerisation in domain II of NS5A. PLoS One. 2010 Oct 27;5(10):e13687.
• [2] SCY-635, a novel nonimmunosuppressive analog of cyclosporine that exhibits potent inhibition of hepatitis C virus RNA replication in vitro. Antimicrob Agents Chemother. 2010 Feb;54(2):660-72.
• [3] 2011 Pipeline of SCYNEXIS.
• [4] Anti-inflammatory effects of a cyclosporine receptor-binding compound, D-43787. J Pharmacol Exp Ther. 2002 May;301(2):738-46.