Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBGTEJ)

• DTT Name: Membrane inhibitor of reactive lysis (CD59)
• Synonyms: Protectin; Membrane attack complex inhibition factor; MSK21; MIRL; MIN3; MIN2; MIN1; MIC11; MEM43 antigen; MACinhibitory protein; MACIP; MACIF; MAC-inhibitory protein; MAC-IP; HRF20; HRF-20; CD59 glycoprotein; 20 kDa homologous restriction factor; 1F5 antigen
• Gene Name: CD59
• DTT Type: Clinical trial target; [1]
• UniProt ID: CD59_HUMAN
• TTD ID: T78552
• Sequence:
  MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
  YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL
  AAAWSLHP
• Function: Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Potent inhibitor of the complement membrane attack complex (MAC) action.
• KEGG Pathway:
  Complement and coagulation cascades (hsa04610)
  Hematopoietic cell lineage (hsa04640)
• Reactome Pathway:
  Cargo concentration in the ER (R-HSA-5694530)
  Neutrophil degranulation (R-HSA-6798695)
  COPI-mediated anterograde transport (R-HSA-6807878)
  Regulation of Complement cascade (R-HSA-977606)
  COPII-mediated vesicle transport (R-HSA-204005)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HMR59	DMMQZ3I	Dry age-related macular degeneration	9B75	Phase 2	[2]

References

• [1] Isolation and functional assay of the membrane complement inhibitors CD55 (DAF) and CD59 (MIRL). Curr Protoc Immunol. 2001 May;Chapter 13:Unit 13.5.
• [2] Clinical pipeline report, company report or official report of Hemera Biosciences.