DTT Name |
HUMAN interleukin-1 beta (IL1B)
|
Synonyms |
IL1F2; IL-1beta; IL-1 beta; Catabolin |
Gene Name |
IL1B
|
BioChemical Class |
Cytokine: interleukin
|
UniProt ID |
|
TTD ID |
|
3D Structure |
|
Sequence |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS
|
Function |
Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Potent proinflammatory cytokine.
|
KEGG Pathway |
- Antifolate resistance (hsa01523 )
- MAPK signaling pathway (hsa04010 )
- Cytokine-cytokine receptor interaction (hsa04060 )
- NF-kappa B signaling pathway (hsa04064 )
- Necroptosis (hsa04217 )
- Osteoclast differentiation (hsa04380 )
- Toll-like receptor signaling pathway (hsa04620 )
- NOD-like receptor signaling pathway (hsa04621 )
- Cytosolic DNA-sensing pathway (hsa04623 )
- C-type lectin receptor signaling pathway (hsa04625 )
- Hematopoietic cell lineage (hsa04640 )
- IL-17 signaling pathway (hsa04657 )
- Th17 cell differentiation (hsa04659 )
- TNF signaling pathway (hsa04668 )
- Inflammatory mediator regulation of TRP channels (hsa04750 )
- Non-alcoholic fatty liver disease (hsa04932 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Alcoholic liver disease (hsa04936 )
- Type I diabetes mellitus (hsa04940 )
- Alzheimer disease (hsa05010 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Shigellosis (hsa05131 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Legionellosis (hsa05134 )
- Yersinia infection (hsa05135 )
- Leishmaniasis (hsa05140 )
- Chagas disease (hsa05142 )
- African trypanosomiasis (hsa05143 )
- Malaria (hsa05144 )
- Amoebiasis (hsa05146 )
- Tuberculosis (hsa05152 )
- Measles (hsa05162 )
- Human cytomegalovirus infection (hsa05163 )
- Influenza A (hsa05164 )
- Herpes simplex virus 1 infection (hsa05168 )
- Coronavirus disease - COVID-19 (hsa05171 )
- Inflammatory bowel disease (hsa05321 )
- Rheumatoid arthritis (hsa05323 )
- Graft-versus-host disease (hsa05332 )
- Lipid and atherosclerosis (hsa05417 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
Reactome Pathway |
- Pyroptosis (R-HSA-5620971 )
- CLEC7A/inflammasome pathway (R-HSA-5660668 )
- Interleukin-10 signaling (R-HSA-6783783 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- Interleukin-1 signaling (R-HSA-9020702 )
- Purinergic signaling in leishmaniasis infection (R-HSA-9660826 )
- Interleukin-1 processing (R-HSA-448706 )
|
|
|
|
|
|
|