Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBTWI1)

DTT Name	Macrophage-derived chemokine (MDC)
Synonyms	Stimulated T-cell chemotactic protein 1; Stimulated T cell chemotactic protein1; Small-inducible cytokine A22; SCYA22; MDC(1-69); CC chemokine STCP-1; C-C motif chemokine 22; A-152E5.1
Gene Name	CCL22
DTT Type	Literature-reported target	[1]
BioChemical Class	Cytokine: CC chemokine
UniProt ID	CCL22_HUMAN
TTD ID	T22117
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Function	Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active. May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine signaling pathway (hsa04062 ) C-type lectin receptor signaling pathway (hsa04625 )
Reactome Pathway	Interleukin-10 signaling (R-HSA-6783783 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) Chemokine receptors bind chemokines (R-HSA-380108 )

References

1	Mononuclear cell-infiltrate inhibition by blocking macrophage-derived chemokine results in attenuation of developing crescentic glomerulonephritis. Am J Pathol. 2003 Apr;162(4):1061-73.