| DTT Name |
HUMAN NADH:ubiquinone oxidoreductase subunit B9 (NDUFB9)
|
| Synonyms |
NADH-ubiquinone oxidoreductase B22 subunit; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9; LYR motif-containing protein 3; Complex I-B22; CI-B22 |
| Gene Name |
NDUFB9
|
| BioChemical Class |
Complex I LYR family
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM
|
| Function |
Human protein NADH:ubiquinone oxidoreductase subunit B9 interacts with SARS-CoV-2 Orf9c protein with high significance, which indicates NDUFB9 as a potential therapeutic target. |
| KEGG Pathway |
- Oxidative phosphorylation (hsa00190 )
- Metabolic pathways (hsa01100 )
- Thermogenesis (hsa04714 )
- Retrograde endocannabinoid signaling (hsa04723 )
- Non-alcoholic fatty liver disease (hsa04932 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Huntington disease (hsa05016 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Diabetic cardiomyopathy (hsa05415 )
|
| Reactome Pathway |
- Complex I biogenesis (R-HSA-6799198 )
- Respiratory electron transport (R-HSA-611105 )
|
| BioCyc Pathway |
- MetaCyc:HS07466-MON
|
|
|
|
|
|
|