Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTC0G1L)

• DTT Name: DNA repair protein RAD51 homolog 1 (RAD51)
• Synonyms: hRAD51; RECA; RAD51A; RAD51 homolog A; HsRAD51
• Gene Name: RAD51
• DTT Type: Clinical trial target; [1]
• UniProt ID: RAD51_HUMAN
• TTD ID: T63083
• Sequence:
  MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
  INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
  SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
  SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
  RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
  YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
• Function: Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR). Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross-link repair.
• KEGG Pathway:
  Homologous recombination (hsa03440)
  Fanconi anemia pathway (hsa03460)
  Pathways in cancer (hsa05200)
  Pancreatic cancer (hsa05212)
• Reactome Pathway:
  HDR through Homologous Recombination (HRR) (R-HSA-5685942)
  Presynaptic phase of homologous DNA pairing and strand exchange (R-HSA-5693616)
  Meiotic recombination (R-HSA-912446)
  HDR through Single Strand Annealing (SSA) (R-HSA-5685938)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CYT-0851	DME6NMJ	B-cell lymphoma	2A86	Phase 1/2	[2]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMP-PNP	DMTOK1D	Discovery agent	N.A.	Investigative	[1]

References

• [1] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [2] National Cancer Institute Drug Dictionary (drug name CYT0851).