Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCF05Y)

DTT Name	Small-inducible cytokine A11 (CCL11)
Synonyms	Smallinducible cytokine A11; SCYA11; Eotaxin; Eosinophil chemotactic protein; CC motif chemokine 11; C-C motif chemokine 11
Gene Name	CCL11
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine: CC chemokine
UniProt ID	CCL11_HUMAN
TTD ID	T16888
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
Function	Binds to CCR3. In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine signaling pathway (hsa04062 ) IL-17 signaling pathway (hsa04657 ) Asthma (hsa05310 )
Reactome Pathway	Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Bertilimumab	DMRC0EQ	Bullous pemphigoid	EB41.0	Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.