Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTD4G7L)
| DTT Name | Interleukin-32 (IL32) | ||||
|---|---|---|---|---|---|
| Synonyms | Tumor necrosis factor alpha-inducing factor; TAIF; Natural killer cells protein 4; NK4; IL-32 | ||||
| Gene Name | IL32 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK |
||||
| Function |
It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK. Cytokine that may play a role in innate and adaptive immune responses.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||