Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDBG95)

• DTT Name: Hepatitis C virus Envelope glycoprotein E2 (HCV NS1)
• Synonyms: Hepacivirus polyprotein
• Gene Name: HCV NS1
• DTT Type: Clinical trial target; [1]
• UniProt ID: POLG_HCV1
• TTD ID: T97759
• Sequence:
  ETHVTGGSAGHTVSGFVSLLAPGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFY
  HHKFNSSGCPERLASCRPLTDFDQGWGPISYANGSGPDQRPYCWHYPPKPCGIVPAKSVC
  GPVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKV
  CGAPPCVIGGAGNNTLHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPYRLWHYPCTIN
  YTIFKIRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLTTTQWQVLPCSFTTLP
  ALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQ
  AEA
• Function: NS5B is an RNA-dependent RNA polymerase that plays an essential role in the virus replication.

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MBL-HCV1	DMJVU7Y	Hepatitis C virus infection	1E51.1	Phase 2	[1]
XTL-6865	DML3K9N	Hepatitis C virus infection	1E51.1	Phase 1	[2]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HuMax-HepC	DMFVB7Z	Hepatitis C virus infection	1E51.1	Terminated	[3]

References

• [1] Human monoclonal antibody MBL-HCV1 delays HCV viral rebound following liver transplantation: a randomized controlled study. Am J Transplant. 2013 Apr;13(4):1047-54.
• [2] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [3] Clinical pipeline report, company report or official report of Genmab.