Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTDTWV0)
| DTT Name | Isocitrate dehydrogenase (IDH) | ||||
|---|---|---|---|---|---|
| Synonyms | Isocitrate dehydrogenase [NAD] | ||||
| Gene Name | IDH1 | ||||
| DTT Type |
Successful target
|
[1] | |||
| BioChemical Class |
CH-OH donor oxidoreductase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL |
||||
| Function | It may tightly associate or interact with the pyruvate dehydrogenase complex. Plays a role in intermediary metabolism and energy production. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85. | ||||
|---|---|---|---|---|---|
| 2 | New Developments in the Pathogenesis and Therapeutic Targeting of the IDH1 Mutation in Glioma. Int J Med Sci. 2015; 12(3): 201-213. | ||||
| 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
