Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTENSOI)

• DTT Name: Nucleoprotein (N)
• Synonyms: N; Nucleocapsid protein; NC; Protein N
• Gene Name: N
• DTT Type: Clinical trial target; [1]
• UniProt ID: NCAP_SARS2
• TTD ID: T63182
• Sequence:
  MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG
  KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG
  LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
  QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
  QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
  WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY
  KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
• Function: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M (PubMed:33264373). Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. {ECO:0000269|PubMed:32974389, ECO:0000269|PubMed:33264373}.; May block host chemokine function in vivo, facilitating viral replication and transmission (PubMed:35921414). Acts by being secreted into the extracellular space where it competes to host chemokines for binding to host glycosaminoglycans (GAG) (PubMed:35921414). {ECO:0000269|PubMed:35921414}.; May induce inflammasome responses in cultured cells and mice. Acts by interacting with host NLRP3 to facilitate inflammasome assembly, which induces cytokine release that may play a role in COVID lung injury. {ECO:0000269|PubMed:34341353}.
• Reactome Pathway:
  (R-HSA-1257604)
  (R-HSA-168638)
  (R-HSA-168928)
  (R-HSA-389357)
  (R-HSA-445989)
  (R-HSA-5218920)
  (R-HSA-9020702)
  (R-HSA-909733)
  (R-HSA-9694322)
  (R-HSA-9694614)
  (R-HSA-9694631)
  (R-HSA-9694635)
  (R-HSA-9694786)
  (R-HSA-9705671)
  (R-HSA-9733458)
  (R-HSA-9755779)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PF-07923567	DMXUVE3	Respiratory syncytial virus infection	1C80	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of Pfizer