Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTERU0T)
| DTT Name | Urotensin II (UTS2) | ||||
|---|---|---|---|---|---|
| Synonyms | Urotensin-II; UTS2; UII; U-II; HU-II | ||||
| Gene Name | UTS2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEML
GAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFW KYCV |
||||
| Function | Highly potent vasoconstrictor. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
