Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTEX3SI)
| DTT Name | MHC class I NK cell receptor 2DL3 (CD158b2) | ||||
|---|---|---|---|---|---|
| Synonyms |
p58.2 MHC class-I-specific NK receptor; p58 natural killer cell receptor clone CL-6; p58 NK receptor CL-6; Natural killer-associated transcript 2; NKAT2b; NKAT2a; NKAT2; NKAT-2; Killer inhibitory receptor cl 2-3; Killer cell immunoglobulin-like receptor 2DL3; KIRCL23; KIR-023GB; CD158B2; CD158 antigen-like family member B2
|
||||
| Gene Name | KIR2DL3 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Immunoglobulin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP |
||||
| Function | Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | Daratumumab-mediated lysis of primary multiple myeloma cells is enhanced in combination with the human anti-KIR antibody IPH2102 and lenalidomide. Haematologica. 2015 Feb;100(2):263-8. | ||||
|---|---|---|---|---|---|
| 2 | Genetic and antibody-mediated reprogramming of natural killer cell missing-self recognition in vivo. Proc Natl Acad Sci U S A. 2009 Aug 4;106(31):12879-84. | ||||
