Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFM7V0)
| DTT Name | Apoptosis regulator BAK (BAK) | ||||
|---|---|---|---|---|---|
| Synonyms | CDN1; Bcl2like protein 7; Bcl2L7; Bcl2-L-7; Bcl2 homologous antagonist/killer; Bcl-2-like protein 7; Bcl-2 homologous antagonist/killer | ||||
| Gene Name | BAK1 | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| BioChemical Class | 
                     B-cell lymphoma Bcl-2 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM 
                        
                    VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS  | 
            ||||
| Function | 
                                         
                        Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases. Plays a role in the mitochondrial apoptosic process.
                        
                     
                                     | 
            ||||
| KEGG Pathway | 
                                    
  | 
            ||||
| Reactome Pathway | |||||
