Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFRES8)
| DTT Name | Regulator of G-protein signaling 16 (RGS16) | ||||
|---|---|---|---|---|---|
| Synonyms | hRGS-r; Retinally abundant regulator of G-protein signaling; Retinal-specific RGS; RGSR; RGS-r; A28-RGS14P | ||||
| Gene Name | RGS16 | ||||
| DTT Type | Patented-recorded target | [1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                            MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL AAQASAASATLSSCSLDEPSHT | ||||
| Function | 
                        Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals. Regulates G protein-coupled receptor signaling cascades.
                        
                     | ||||
| Reactome Pathway | |||||
