Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFTWQ8)
| DTT Name | Multiple tumor suppressor 1 (CDKN2A) | ||||
|---|---|---|---|---|---|
| Synonyms | p16INK4A; Tumour suppressor gene p16; P16-INK4a; P16-INK4; P16 gene; MTS-1; Cyclin-dependent kinase inhibitor 2A; Cyclin-dependent kinase 4 inhibitor A; CDK4I | ||||
| Gene Name | CDKN2A | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
||||
| Function |
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway |
|
||||