Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFX379)
| DTT Name | Rhombotin-2 (LMO2) | ||||
|---|---|---|---|---|---|
| Synonyms | TTG2; T-cell translocation protein 2; RHOM2; RBTNL1; RBTN2; LMO-2; LIM-only protein 2; LIM-domain protein Lmo2; LIM domain only protein 2; Cysteine-rich protein TTG-2; Cysteine rich protein TTG-2 | ||||
| Gene Name | LMO2 | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                        MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC 
                    
                GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI  | 
            ||||
| Function | Acts with LDB1 to maintain erythroid precursors in an immature state. Acts with TAL1/SCL to regulate red blood cell development. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
