Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTG01U6)
| DTT Name | HUMAN c-reactive protein (CRP) | ||||
|---|---|---|---|---|---|
| Synonyms | C reactive protein | ||||
| Gene Name | CRP | ||||
| BioChemical Class |
Pentraxin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP |
||||
| Function |
Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
|
||||
| Reactome Pathway | |||||