Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTG9CFY)

• DTT Name: Bacterial Dihydroneopterinaldolase (Bact folB)
• Synonyms: folB of Escherichia coli; FOLB of Escherichia coli; DHNA of Escherichia coli; 7,8-Dihydroneopterin aldolase
• Gene Name: Bact folB
• DTT Type: Discontinued target; [1]
• BioChemical Class: Carbon-carbon lyase
• UniProt ID: FOLB_ECOLI
• TTD ID: T40730
• Sequence:
  MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETV
  VSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLKE
  NN
• Function: Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin. Can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin,but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin at appreciable velocity.
• KEGG Pathway:
  Folate biosynthesis (ecj00790)
  Metabolic pathways (ecj01100)
  Biosynthesis of cofactors (ecj01240)
• BioCyc Pathway:
  MetaCyc:H2NEOPTERINALDOL-MON
  EcoCyc:H2NEOPTERINALDOL-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Bropirimine	DMMT1YQ	Virus infection	1A24-1D9Z	Discontinued in Phase 3	[1]

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
6-Hydroxymethyl-7,8-Dihydropterin	DMYF60K	Discovery agent	N.A.	Investigative	[1]
7,8-dihydrobiopterin	DMQU4XM	Discovery agent	N.A.	Investigative	[1]
7,8-Dihydroneopterin	DM5TXY1	Discovery agent	N.A.	Investigative	[1]
8-Amino-1,3-Dimethyl-3,7-Dihydropurine-2,6-Dione	DM84D9W	Discovery agent	N.A.	Investigative	[1]
9-Methylguanine	DM54FRI	Discovery agent	N.A.	Investigative	[1]

References

• [1] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.