| DTT Name |
Gamma-actin (ACTG)
|
| Synonyms |
Actin, cytoplasmic 2; ACTG |
| Gene Name |
ACTG1
|
| DTT Type |
Literature-reported target
|
[1] |
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF
|
| Function |
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. |
| KEGG Pathway |
- Rap1 signaling pathway (hsa04015 )
- Phagosome (hsa04145 )
- Apoptosis (hsa04210 )
- Hippo signaling pathway (hsa04390 )
- Focal adhesion (hsa04510 )
- Adherens junction (hsa04520 )
- Tight junction (hsa04530 )
- Platelet activation (hsa04611 )
- Neutrophil extracellular trap formation (hsa04613 )
- Leukocyte transendothelial migration (hsa04670 )
- Thermogenesis (hsa04714 )
- Regulation of actin cytoskeleton (hsa04810 )
- Thyroid hormone signaling pathway (hsa04919 )
- Oxytocin signaling pathway (hsa04921 )
- Gastric acid secretion (hsa04971 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Bacterial invasion of epithelial cells (hsa05100 )
- Vibrio cholerae infection (hsa05110 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Shigellosis (hsa05131 )
- Salmonella infection (hsa05132 )
- Yersinia infection (hsa05135 )
- Influenza A (hsa05164 )
- Proteoglycans in cancer (hsa05205 )
- Hepatocellular carcinoma (hsa05225 )
- Hypertrophic cardiomyopathy (hsa05410 )
- Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
- Dilated cardiomyopathy (hsa05414 )
- Viral myocarditis (hsa05416 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Gap junction degradation (R-HSA-190873 )
- Formation of annular gap junctions (R-HSA-196025 )
- Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
- EPHB-mediated forward signaling (R-HSA-3928662 )
- EPH-ephrin mediated repulsion of cells (R-HSA-3928665 )
- Adherens junctions interactions (R-HSA-418990 )
- Recycling pathway of L1 (R-HSA-437239 )
- VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
- Interaction between L1 and Ankyrins (R-HSA-445095 )
- Cell-extracellular matrix interactions (R-HSA-446353 )
- RHO GTPases activate IQGAPs (R-HSA-5626467 )
- RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213 )
- RHO GTPases Activate Formins (R-HSA-5663220 )
- MAP2K and MAPK activation (R-HSA-5674135 )
- Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
- Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 )
- Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
- Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
- Clathrin-mediated endocytosis (R-HSA-8856828 )
- RHOBTB2 GTPase cycle (R-HSA-9013418 )
- Signaling downstream of RAS mutants (R-HSA-9649948 )
- Signaling by RAF1 mutants (R-HSA-9656223 )
- Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360 )
- Sensory processing of sound by outer hair cells of the cochlea (R-HSA-9662361 )
- FCGR3A-mediated phagocytosis (R-HSA-9664422 )
- Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )
|
|
|
|
|
|
|