Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTGQA9W)
| DTT Name | Apolipoprotein A-II (APOA2) | ||||
|---|---|---|---|---|---|
| Synonyms | Apolipoprotein A2; ApoA-II; Apo-AII | ||||
| Gene Name | APOA2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Apolipoprotein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
||||
| Function | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
