Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHMW3T)

• DTT Name: Thymic stromal lymphopoietin (TSLP)
• Synonyms: Thymic stromal lymphopoietin
• Gene Name: TSLP
• DTT Type: Clinical trial target; [1]
• UniProt ID: TSLP_HUMAN
• TTD ID: T85857
• Sequence:
  MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
  TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
  TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Function: Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
• Reactome Pathway: Interleukin-7 signaling (R-HSA-1266695)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tezepelumab	DM9R5J6	Severe asthma	CA23	Approved	[2]

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
A378	DMUWRTB	Asthma	CA23	IND submitted	[3]
CSJ117	DMZJUV6	Asthma	CA23	Phase 2	[4]
MEDI9929	DMGD1YP	Asthma	CA23	Phase 2	[1]
AMG 104	DM3XC31	Asthma	CA23	Phase 1	[5]
AZD8630	DMMUF0O	Asthma	CA23	Phase 1	[6]
PF-07275315	DMHRVUY	Atopic dermatitis	EA80	Phase 1	[7]
SAR443765	DMLYI4Z	Asthma	CA23	Phase 1	[8]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	8.89E-01	0.3	0.26

References

• [1] Human immunoglobulin G2Lambda monoclonal antibody directed against thymic stromal lymphopoietin (MEDI9929). European medicines agency science medicines health (EMEA-001613-PIP01-14). European Union. 2015.
• [2] Tezepelumab in Adults with Uncontrolled Asthma. N Engl J Med. 2017 Sep 7;377(10):936-946.
• [3] Clinical pipeline report, company report or official report of Klus Pharma
• [4] TSLP Inhibitors for Asthma: Current Status and Future Prospects. Drugs. 2020 Apr;80(5):449-458.
• [5] Clinical pipeline report, company report or official report of Amgen
• [6] Clinical pipeline report, company report or official report of AstraZeneca
• [7] Clinical pipeline report, company report or official report of Pfizer
• [8] Clinical pipeline report, company report or official report of Sanofi