Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHPFTS)

DTT Name Plasmodium Beta-hydroxyacyl-ACP dehydratase (Malaria FabZ)
Synonyms fabZ; Fatty acid synthesis protein; Beta-hydroxyacyl-ACP dehydratase; 17 kDa actomyosin component; (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; (3R)-hydroxymyristoyl-ACP dehydrase
Gene Name Malaria FabZ
DTT Type
Clinical trial target
 [1]
UniProt ID
Q965D7_PLAFA
TTD ID
T01943
Sequence
MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV
SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL
KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK
KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
Function Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs.
KEGG Pathway
Fatty acid biosynthesis (pfa00061 )
Biotin metabolism (pfa00780 )
Metabolic pathways (pfa01100 )
Fatty acid metabolism (pfa01212 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Epigallocatechin gallate DMCGWBJ Hepatic fibrosis DB93.0 Phase 3 [2]
------------------------------------------------------------------------------------
6 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-CATECHINGALLATE DMZOGSK Discovery agent N.A. Investigative [2]
2-Hexadecynoic acid DMTFIPZ Discovery agent N.A. Investigative [3]
3,7,3',4'-TETRAHYDROXYFLAVONE DMES906 Discovery agent N.A. Investigative [2]
biochanin A DM0HPWY Discovery agent N.A. Investigative [2]
GALLOCATECHIN GALLATE DMX2084 Discovery agent N.A. Investigative [2]
MORIN DM2OGZ5 Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Investigative Drug(s)

References

1 Antiplasmodial drug targets: a patent review (2000 - 2013).Expert Opin Ther Pat. 2016;26(1):107-30.
2 Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. J Med Chem. 2006 Jun 1;49(11):3345-53.
3 2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. Bioorg Med Chem. 2010 Nov 1;18(21):7475-85.