Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTHXFA1)
| DTT Name | C5a anaphylatoxin chemotactic receptor (C5AR1) | ||||
|---|---|---|---|---|---|
| Synonyms | CD88; C5aR; C5a-R; C5a anaphylatoxin chemotactic receptor 1; C5R1 | ||||
| Gene Name | C5AR1 | ||||
| DTT Type | 
                     Clinical trial target 
                 | 
                [1] | |||
| BioChemical Class | 
                     GPCR rhodopsin 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW 
                        
                    VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV  | 
            ||||
| Function | 
                                         
                        The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production. Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a.
                        
                     
                                     | 
            ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Approved Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||
| 
                     1 Clinical Trial Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||
| 
                     2 Discontinued Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||
| 
                     1 Preclinical Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||
| 
                     4 Investigative Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | Clinical pipeline report, company report or official report of ChemoCentryx. | ||||
|---|---|---|---|---|---|
| 2 | Company report (Arana Therapeutics) | ||||
| 3 | Complement in immune and inflammatory disorders: therapeutic interventions. J Immunol. 2013 Apr 15;190(8):3839-47. | ||||
| 4 | Development and validation of a LC-MS/MS assay for pharmacokinetic studies of complement C5a receptor antagonists PMX53 and PMX205 in mice. Sci Rep. 2018 May 25;8(1):8101. | ||||
| 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 32). | ||||
| 6 | Molecular characterization of the gerbil C5a receptor and identification of a transmembrane domain V amino acid that is crucial for small molecule ... J Biol Chem. 2005 Dec 9;280(49):40617-23. | ||||
| 7 | Identification of a potent and orally active non-peptide C5a receptor antagonist. J Biol Chem. 2002 Dec 20;277(51):49403-7. | ||||
